PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016454035.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 577aa    MW: 66202.8 Da    PI: 9.9499
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016454035.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B346.19e-151494599
                    -..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3  5 ltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                          +k++ l +pk f+ ++ +g ++e     +  + +++W vkl  ++++    l++GW++F+++++L+ gD ++F+++g++ef   v++f++
  XP_016454035.1 14 I--QPGFKRA-LKIPKGFL-KYlKGHEHE---HAVLKRGSKKWLVKL--NGQR----LEEGWEKFAEEHDLRLGDLLIFRHEGEMEF--EVTIFDS 94
                    4..4556666.9*******.564666444...57778899*******..8887....***********************9999999..9999986 PP

2B344.33.1e-14140221589
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                     +++s+ +++g ++lp kf++++g  + ++  l+++de+ rsW++kl    + +++++++ W eF +an++k+gD ++Fk++ + e
  XP_016454035.1 140 TVRSYCFSKGYFRLPVKFTKANGFRN-KKYGLIIRDERQRSWNLKL--YTSYSQVYIGGKWGEFRDANDIKVGDRIMFKVVANGE 221
                     57899*****************5543.4467***************..66667889***********************887533 PP

3B3551.5e-17285371596
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                     ++++++l+++ l++p +fa++hg+  ++  t++++d + rsW+++l    +++ +++++GW +F+ an LkegD v+F  +  +++++ +k+
  XP_016454035.1 285 TMKPYNLSKCFLRVPSPFARQHGLRDRK-CTIMIRD-EQRSWTFTL--YSCGKVTYIGGGWHDFCIANCLKEGDRVMFGIVA-NGEKPILKF 371
                     6799******************999766.5999999.779******..899999*************************876.555566665 PP

4B355.51e-17429516396
                     EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                     +++ ++++l+++ l +p +fa++hg+   +  t+++ d + rsW+++l    +++ +++++GW+eF+ an LkegD v+F+ +  +++++ +k+
  XP_016454035.1 429 STM-KPYYLSKRFLHVPSPFARQHGLGDGRC-TIMISD-EQRSWTFNL--YSCGRFTYIGGGWREFCVANYLKEGDRVMFEIVA-NGEKPILKF 516
                     444.778888888***********7775553.666555.88*******..999999*************************877.555566665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.5E-21497IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.73E-19597IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.294795IPR003340B3 DNA binding domain
CDDcd100175.25E-15893No hitNo description
SMARTSM010191.3E-161095IPR003340B3 DNA binding domain
PfamPF023621.2E-101994IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.8E-13134227IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.87E-15136227IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.3E-9136231IPR003340B3 DNA binding domain
PROSITE profilePS5086311.265136230IPR003340B3 DNA binding domain
PfamPF023621.6E-12140223IPR003340B3 DNA binding domain
CDDcd100171.26E-10142215No hitNo description
SuperFamilySSF1019365.69E-20277371IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.109.2E-20278371IPR015300DNA-binding pseudobarrel domain
CDDcd100175.62E-15280373No hitNo description
PROSITE profilePS5086310.969281374IPR003340B3 DNA binding domain
SMARTSM010193.6E-15281375IPR003340B3 DNA binding domain
PfamPF023629.4E-15284372IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.8E-20423516IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.08E-19423516IPR015300DNA-binding pseudobarrel domain
CDDcd100171.89E-15425518No hitNo description
PROSITE profilePS5086311.899426519IPR003340B3 DNA binding domain
SMARTSM010197.5E-16427520IPR003340B3 DNA binding domain
PfamPF023621.1E-15428517IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 577 aa     Download sequence    Send to blast
MKVRPAKPHF FKPIQPGFKR ALKIPKGFLK YLKGHEHEHA VLKRGSKKWL VKLNGQRLEE  60
GWEKFAEEHD LRLGDLLIFR HEGEMEFEVT IFDSSHCDRE YAEYLQDEEE AHIVKDPSKK  120
FEIKEAAPQN PIGQSHVVCT VRSYCFSKGY FRLPVKFTKA NGFRNKKYGL IIRDERQRSW  180
NLKLYTSYSQ VYIGGKWGEF RDANDIKVGD RIMFKVVANG ERPIWKFHNL RKNASLQPEG  240
KNNSDIERVS TPEKPKSNII SSCKAVPNVE AAKDLHLGHP HFICTMKPYN LSKCFLRVPS  300
PFARQHGLRD RKCTIMIRDE QRSWTFTLYS CGKVTYIGGG WHDFCIANCL KEGDRVMFGI  360
VANGEKPILK FHDLRENASF QPEGKKTNSD TERVSTQEKP KSNIISSRKA VPNVEAAKDV  420
HLSQPHFIST MKPYYLSKRF LHVPSPFARQ HGLGDGRCTI MISDEQRSWT FNLYSCGRFT  480
YIGGGWREFC VANYLKEGDR VMFEIVANGE KPILKFHDLR GNASLQPEGK KINLDAKNVS  540
TQDLTIQTSN VTARKAQVPA STSVDNANTK TTLVYTM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754472e-61HG975447.1 Solanum pennellii chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009781534.10.0PREDICTED: B3 domain-containing protein REM10-like isoform X2
RefseqXP_016454035.10.0PREDICTED: B3 domain-containing protein REM10-like isoform X2
TrEMBLM1AKH20.0M1AKH2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000246730.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.14e-56B3 family protein